Bioinformatics Database
VEGFA: Vascular endothelial growth factor A
Cellular Process
Bud stage of tooth development
Gene Name
VEGFA: Vascular endothelial growth factor A
Gene ID
7422
Gene Sequence
General Description
This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression
Alternative titles; symbols
VEGF
Chromosome
Chromosome 6
Cytogenetic location
6p21.1
Encoded Protein
Vascular endothelial growth factor A isoform b https://www.ncbi.nlm.nih.gov/protein/NP_003367.4/
Function of the protein in oral and tooth development
Teeth are richly supported by blood vessels and peripheral nerves. Shadad et al., (2019) conducted study to to describe in detail the developmental time‐course and localization of blood vessels during early tooth formation. In their results VEGF showed developmentally regulated epithelial and mesenchymal mRNA expression domains including the enamel knot signaling centers that correlated with the growth and navigation of the blood vessels expressing Vegfr2 and VEGFR2 to the dental papilla and enamel organ. Developing blood vessels were present in the jaw mesenchyme including the presumptive dental mesenchyme before the appearance of the epithelial dental placode and dental neurites. Similarly, formation of a blood vessel plexus around the bud stage tooth germ and ingrowth of vessels into dental papilla at E14 preceded ingrowth of neurites (Shadad et al., 2019).
Dental and Oral Diseases
Protein Sequence
>NP_003367.4 vascular endothelial growth factor A isoform b [Homo sapiens]
MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVR
AGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALA
RASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMA
EGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEES
NITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPC
SERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Mutations
Related Literature
Shadad et al., (2019). https://doi.org/10.1111/joa.12950