Bioinformatics Database
TGFB1: Transforming growth factor beta 1
3D Protein Structure Viewer
Cellular Process
Dentin formation
Gene Name
TGFB1: Transforming growth factor beta 1
Gene ID
7040
Gene Sequence
General Description
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease
Alternative titles; symbols
TGF-BETA; TGFB
Chromosome
Chromosome 19
Cytogenetic location
19q13.2
Encoded Protein
Transforming growth factor beta-1 proprotein preproprotein
Function of the protein in oral and tooth development
Thyagarajan et al. (2001) developed transgenic mice that overexpressed Tgfb1 predominantly in odontoblasts. The teeth of transgenic mice expressing this construct showed a significant reduction in tooth mineralization, defective dentin formation, and a relatively high branching of dentinal tubules. Dentin extracellular matrix components were increased and deposited abnormally in the dental pulp. Expression of Dspp was significantly downregulated.
Dental and Oral Diseases
Protein Sequence
>NP_000651.3 transforming growth factor beta-1 proprotein preproprotein [Homo sapiens]
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPP
GPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSEL
REAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSR
GGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRAL
DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA
SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Mutations
Related Literature
Thyagarajan et al., (2001): https://doi.org/10.1074/jbc.M010502200