Bioinformatics Database
ODAPH: Odontogenesis Associated Phosphoprotein
3D Protein Structure Viewer
Cellular Process
Enamel formation
Gene Name
ODAPH: Odontogenesis Associated Phosphoprotein
Gene ID
152816
Gene Sequence
General Description
ODAPH encodes an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis.
Alternative titles; symbols
Chromosome 4 Open Reading Frame 26; C4ORF26
Chromosome
Chromosome 4
Cytogenetic location
4q21.1
Encoded Protein
Odontogenesis associated phosphoprotein isoform 2 precursor
Function of the protein in oral and tooth development
Synthetic peptide corresponding to the phosphorylated C terminus of C4ORF26 promoted hydroxyapatite nucleation and supported crystal growth (Parry et al, 2012).
Dental and Oral Diseases
Amelogenesis imperfecta, type IIA4
(OMIM ID: 614829)
Protein Sequence
>NP_848592.2 ODAPH [organism=Homo sapiens] [GeneID=152816] [isoform=2 precursor]
MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC
PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES
Mutations
A homozygous 229C-T transition, ARG77TER in the C4ORF26 gene is reported by Parry et al. (2012), resulting in an arg77-to-ter (R77X) substitution. Other mutations causing amelogenesis imperfecta type IIA4 includes CYS43TER , TRP106TER, 6-BP DEL/16-BP INS and mutation in the splice acceptor site of intron 1 (Parry et al., 2012)
Related Literature
Parry et al., (2012): https://doi.org/10.1016/j.ajhg.2012.07.020
