Bioinformatics Database
HTRA1: HtrA serine peptidase 1

Cellular Process
Dentin formation
Gene Name
HTRA1: HtrA serine peptidase 1
Gene ID
5654
Gene Sequence
General Description
This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.
Alternative titles; symbols
HtrA, E. COLI, HOMOLOG OF; HTRA PROTEASE, SERINE, 11; PRSS11j; High-temperature requirement protein A1
Chromosome
Chromosome 10
Cytogenetic location
10q26.13
Encoded Protein
Serine protease HTRA1 precursor
Function of the protein in oral and tooth development
In a study by Li et al., (2012), rats were randomly sacrificed after direct pulp capping on days 0, 7, 14, and 21, their maxillary segments were obtained for histological analysis. HtrA1, matrix Gla protein (MGP), nestin, and bone sialoprotein were positively stained in the odontoblasts and reparative dentin during induced reparative dentin formation. The researchers found that the expressions of HtrA1 and MGP were significantly enhanced after direct pulp capping on day 7 and did not significantly change between days 7, 14, and day 21. From the observation, the authors concluded that HtrA1 could be involved in the process of reparative dentin formation associated with MGP (Li et al., 2012).
Dental and Oral Diseases
Protein Sequence
>NP_002766.1 serine protease HTRA1 precursor [Homo sapiens]
MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGA
PEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSE
RLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVS
EDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVV
AIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAG
ISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
Mutations
Related Literature
Li et al., (2012): https://doi.org/10.1016/j.joen.2012.03.009