Bioinformatics Database
CLDN16: Claudin 16
3D Protein Structure Viewer
Cellular Process
Enamel formation
Gene Name
CLDN16: Claudin 16
Gene ID
10686
Gene Sequence
General Description
The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.
Alternative titles; symbols
Paracellin 1; PCLN1
Chromosome
Chromosome 3
Cytogenetic location
3q28
Encoded Protein
Function of the protein in oral and tooth development
Adult mice with no Cldn16 expressed severe enamel loss, fragile enamel, dentin exposure, and decreased mineralization (Bardet et al., 2016). Immunostaining of incisors and molar germs revealed that Cldn16 expression was localized in the tight junction of secretory ameloblasts in the tooth germ. Absence of Cldn16 in the secretory ameloblasts resulted in significantly lower pH in the forming enamel matrix, affecting early enamel maturation (Bardet et al., 2016).
Dental and Oral Diseases
Protein Sequence
>NP_006571.2 CLDN16 [organism=Homo sapiens] [GeneID=10686]
MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAE
HPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAV
DVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAA
GVSMAKSYSAPRTETAKMYAVDTRV
Mutations
Related Literature
Bardet et al., (2016): https://doi.org/10.1002/jbmr.2726
