Bioinformatics Database

ATF2: Activating Transcription Factor 2

ATF2: Activating Transcription Factor 2
3D Protein Structure Viewer​
Cellular Process
Enamel formation
Gene Name
ATF2: Activating Transcription Factor 2
Gene ID
1386
General Description
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions
Alternative titles; symbols
CREBP1b cAMP Response Element-binding Protein 2
Chromosome
Chromosome 2
Cytogenetic location
2q31.1
Encoded Protein

cyclic AMP-dependent transcription factor ATF-2 isoform 1

https://www.ncbi.nlm.nih.gov/protein/NP_001871.2/

Function of the protein in oral and tooth development

As suggested by Mednieks et al,(1998): "Cyclic AMP receptor proteins (cARP) are present in a variety of cell types. Intra-cellularly, they are the regulatory (R) subunits of type II cyclic AMP-dependent protein kinase. Additionally, cARP are secretory products of several cell types. That cARP are present in and secreted by ameloblasts into the enamel matrix of the rat incisor was demonstrated by photoaffinity labeling, Western blotting and immunogold cytochemistry. Gold particles were present over cytoplasmic regions including Tomes' Processes of secretory ameloblasts, secretory granules and in the Golgi region. Specific RII labeling was seen in the enamel matrix, but not in dentin. The enamel matrix was more reactive during early maturation compared to the secretory stage of amelogenesis. Nuclear labeling with the RII antibody showed higher intensity in maturation than in secretory ameloblasts. These results demonstrate that cARP are expressed in ameloblasts and secreted into the enamel matrix. The role(s) of cARP in enamel matrix mineralization and the involvement of PKA-regulated pathways in enamel protein synthesis and secretion remain to be determined." Mednieks et al,(1998).

Dental and Oral Diseases
Protein Sequence
>NP_001871.2 cyclic AMP-dependent transcription factor ATF-2 isoform 1 [Homo sapiens]
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTP
TPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPH
PESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVP
VPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKA
ALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANED
PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALS
QIVMAPSSQSQPSGS
Mutations
Related Literature