Bioinformatics Database
PTHLH: Parathyroid hormone like hormone
Cellular Process
Tooth Eruption
Gene Name
PTHLH: Parathyroid hormone like hormone
Gene ID
5744
Gene Sequence
General Description
The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2).
Alternative titles; symbols
PTHLH
Chromosome
Chromosome 12
Cytogenetic location
12p11.22
Encoded Protein
Parathyroid hormone-related protein isoform 1 preproprotein
Function of the protein in oral and tooth development
Studies in transgenic mice showed that PTHRP, and signaling through the PTH/PTHRP receptor, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth (Wysolmerski et al., 1998; Philbrick et al., 1998). Loss-of-function mutations in the PTHR1 gene result in a rare, lethal form of dwarfism known as Blomstrand chondrodysplasia. Wysolmerski et al. (2001) studied fetuses with Blomstrand chondrodysplasia. The results reported taht the fetuses and developing teeth, but they were severely impacted within the surrounding alveolar bone, leading to distortions in their architecture and orientation. The authors concluded that impairment of the PTHRP/PTHR1 signaling pathway in humans is associated with severe abnormalities in tooth development (Wysolmerski et al., 2001).
Dental and Oral Diseases
Protein Sequence
>NP_945316.1 parathyroid hormone-related protein isoform 1 preproprotein [Homo sapiens]
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Mutations
Related Literature
Philbrick et al., (1998). https://doi.org/10.1073/pnas.95.20.11846
Wysolmerski et al., (1998). https://doi.org/10.1242/dev.125.7.1285
Wysolmerski et al., (2001). https://doi.org/10.1210/jcem.86.4.7404